RNPEP Rabbit Polyclonal Antibody TA344801 from OriGene Technologies | Biocompare.com

Supplier Images

RNPEP Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RNPEP Rabbit Polyclonal Antibody

The RNPEP Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Mouse antigen. The RNPEP Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Rnpep Antibody - C-terminal region

Product Specs
ItemRNPEP Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA344801
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetRNPEP
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Rnpep antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rnpep. Synthetic peptide located within the following region: TCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKG
NCBI Full Gene Namearginyl aminopeptidase
NCBI Gene AliasesAPB, AP-B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!